IUBio GIL .. BIOSCI/Bionet News .. Biosequences .. Software .. FTP

[Protein-analysis] unknown tag sequence

Luke via proteins%40net.bio.net (by ke_lu from yahoo.com)
Tue Apr 15 14:31:32 EST 2008


We got a vector from another lab.
After sequencing, I found a fragment besides target gene:
SDPLVQCGGILQISSTVAAARGHPFEGKPIPNPLLGLDSTRTG

Anybody knows what is the name of this tag?
I tried BLAST, but still have no idea.

Luke 




More information about the Proteins mailing list

Send comments to us at archive@iubio.bio.indiana.edu