Looking for HRP-conjugated antibody against Phospho-Threonine site from STK16 kinase

[Mike Autry]

Methods:

I would like to run a Western blot using an antibody to recognize a phospho-threonine residue (P-Thr) phosphorylated by serine/threonine kinase 16 (STK16).

BIOCOMPARE lists 66 commercially available antibodies for P-Thr (http://www.biocompare.com/).

Does anyone have any recommendations on purchasing a commercially available P-Thr antibody?

I typically use HRP conjugated secondary for colorimetric detection with DAB.

My target is as follows:

Protein:             sarcolipin
Species:            rabbit
Sequence:         MERSTRELCLNFTVVLITVILIWLLVRSYQY
Mw:                 3733 Da
Genbank:          U96091<http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=1943760>
Kinase:             serine-threonine kinase 16
Site:                  Thr-5

Thanks,

J. Michael Autry, PhD
Research Associate, University of Minnesota
Minnesota Muscle Laboratory, David D. Thomas, PI
http://ddt.biochem.umn.edu/