From usenet.ucs.indiana.edu!sol.ctr.columbia.edu!zaphod.mps.ohio-state.edu!uakari.primate.wisc.edu!ames!bionet!milton.u.washington.edu Tue Aug 18 17:32:59 EST 1992 Article: 48 of bionet.announce Path: usenet.ucs.indiana.edu!sol.ctr.columbia.edu!zaphod.mps.ohio-state.edu!uakari.primate.wisc.edu!ames!bionet!milton.u.washington.edu From: henikoff@milton.u.washington.edu (Steven Henikoff) Newsgroups: bionet.announce Subject: New e-mail server for homology searching Message-ID: <1992Aug18.181228.3972@u.washington.edu> Date: 18 Aug 92 18:12:28 GMT Sender: kristoff@genbank.bio.net Distribution: bionet Organization: University of Washington, Seattle Lines: 52 Approved: bionews-moderator@genbank.bio.net ___________ ___________ ___________ |\ __________\ |___________| /__________ /| | | | | | | | | | | **********| |***********| |********** | | | | * BLOCKS | | E-MAIL | |SEARCHER * | | | | **********| |***********| |********** | | \|___________|___________|___________|___________|___________|/ |\ __________\ /__________ /| | | JC Wallace| | Copyright | | | | S Agus | | Fred | | | |JG Henikoff| | Hutchinson| | | | S Henikoff| | Center | | \|___________| |____1992___|/ As an aid to detection and verification of protein sequence homology, we introduce the BLOCKS e-mail searcher, which compares a protein or DNA sequence to the current database of protein blocks. Blocks are short multiply aligned ungapped segments corresponding to the most highly conserved regions of proteins. A database of blocks has been constructed by successive application of the automated PROTOMAT system to individual entries in the PROSITE catalog of protein groups keyed to the SWISS-PROT protein sequence databank. The rationale behind searching a database of blocks is that information from multiply aligned sequences is present in a concentrated form, reducing background and increasing sensitivity to distant relationships. If a particular block scores highly, it is possible that the sequence is related to the group of sequences the block represents. Typically, a group of proteins has more than one region in common and their relationship is represented as a series of blocks separated by unaligned regions. If a second block for a group also scores highly in the search, the evidence that the sequence is related to the group is strengthened, and is further strengthened if a third block also scores it highly, and so on. For a detailed help file, send a blank e-mail message as follows: To: blocks@howard.fhcrc.org Subject: help Or just send a protein or DNA sequence in FASTA, Genepro, GenBank, EMBL, SWISS- PROT, or PIR formats (DNA is automatically translated in all 6 reading frames for searching). Here is an example of a protein query in FASTA format: To: blocks@howard.fhcrc.org Subject: >YCZ2_YEAST Hypothetical 40.1 KD protein in HMR 3' region MKAVVIEDGKAVVKEGVPIPELEEGFVLIKTLAVAGNPTDWAHIDYKVGPQGSILGCDAA GQIVKLGPAVDPKDFSIGDYIYGFIHGSSVRFPSNGAFAEYSAISTVVAYKSPNELKFLG EDVLPAGPVRSLEGAATIPVSLTTAGLVLTYNLGLNLKWEPSTPQRNGPILLWGGATAVG QSLIQLANKLNGFTKIIVVASRKHEKLLKEYGADQLFDYHDIDVVEQIKHKYNNISYLVD CVANQNTLQQVYKCAADKQDATVVELTNLTEENVKKENRRQNVTIDRTRLYSIGGHEVPF GGITFPADPEARRAATEFVKFINPKISDGQIHHIPARVYKNGLYDVPRILEDIKIGKNSG EKLVAVLN